Rabbit anti-Human Rad23B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12025P

• Product Name:
• Rabbit anti-Human Rad23B Polyclonal Antibody

• Synonym:
• P58; HR23B; HHR23B; Rad23B

• Description:
• The antibody against Rad23B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Rad23B (NP_002865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Rad23B (NP_002865.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Rad23B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSM

• Gene ID:
• 5887

• Uniprot-ID:
• P54727

• Purification Method:
• Affinity purification

• Positive Samples:
• SK-OV-3