Rabbit anti-Human RAD17 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00429P

• Product Name:
• Rabbit anti-Human RAD17 Polyclonal Antibody

• Synonym:
• CCYC; R24L; RAD24; HRAD17; RAD17SP; RAD17

• Description:
• The antibody against RAD17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 391-670 of human RAD17 (NP_002864.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 391-670 of human RAD17 (NP_002864.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RAD17

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KILYCKRASLTELDSPRLPSHLSEYERDTLLVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCLQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT

• Gene ID:
• 5884

• Uniprot-ID:
• O75943

• Purification Method:
• Affinity purification

• Positive Samples:
• SW480, BT-474, K-562, 22Rv1, Raji