Rabbit anti-Human PVRL1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00529P

• Product Name:
• Rabbit anti-Human PVRL1 Polyclonal Antibody

• Synonym:
• ED4; PRR; HIgR; HV1S; HVEC; OFC7; PRR1; PVRR; CD111; PVRL1; PVRR1; SK-12; CLPED1; nectin-1

• Description:
• The antibody against PVRL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-517 of human PVRL1 (NP_002846.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 450-517 of human PVRL1 (NP_002846.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PVRL1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYGDRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV

• Gene ID:
• 5818

• Uniprot-ID:
• Q15223

• Purification Method:
• Affinity purification

• Positive Samples:
• BT-474, HepG2, Mouse liver