Rabbit anti-Human PTPRO Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03030P

• Product Name:
• Rabbit anti-Human PTPRO Polyclonal Antibody

• Synonym:
• D28; PTPBK; PTPU2; PTPoc; GLEPP1; PTPROt; PTPphi; Ptpn15; R-PTP-O; PTPRO

• Description:
• The antibody against PTPRO was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 637-827 of human PTPRO (NP_035346.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 637-827 of human PTPRO (NP_035346.3).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PTPRO

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SFITAPVAPEITSVEYFNSLLYISWTYGDATTDLSHSRMLHWMVVAEGRKKIKKSVTRNVMTAILSLPPGDIYNLSVTACTERGSNTSLPRLVKLEPAPPKSLFAVNKTQTSVTLLWVEEGVADFFEVFCQQLGSGHNGKLQEPVAVSSHVVTISSLLPATAYNCSVTSFSHDTPSVPTFIAVSTMVTEVN

• Gene ID:
• 19277

• Purification Method:
• Affinity purification