Rabbit anti-Human PTPRN Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03046P

• Product Name:
• Rabbit anti-Human PTPRN Polyclonal Antibody

• Synonym:
• IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; PTPRN

• Description:
• The antibody against PTPRN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-889 of human PTPRN (NP_001186693.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 600-889 of human PTPRN (NP_001186693.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PTPRN

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• STGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQ

• Gene ID:
• 5798

• Uniprot-ID:
• Q16849

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, NIH/3T3, Raji, Mouse brain, Rat brian