Rabbit anti-Human PTP4A2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05130P

• Product Name:
• Rabbit anti-Human PTP4A2 Polyclonal Antibody

• Synonym:
• HH13; OV-1; PRL2; HH7-2; PRL-2; PTP4A; HU-PP-1; PTPCAAX2; ptp-IV1a; ptp-IV1b; PTP4A2

• Description:
• The antibody against PTP4A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human PTP4A2 (NP_536316.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human PTP4A2 (NP_536316.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PTP4A2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVH

• Gene ID:
• 8073

• Uniprot-ID:
• Q12974

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, Mouse skeletal muscle, Mouse brain, Mouse kidney, Mouse liver, Rat brain