Rabbit anti-Human PSMB4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09661P

• Product Name:
• Rabbit anti-Human PSMB4 Polyclonal Antibody

• Synonym:
• HN3; HsN3; PRAAS3; PROS26; PROS-26; PSMB4

• Description:
• The antibody against PSMB4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human PSMB4 (NP_002787.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human PSMB4 (NP_002787.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PSMB4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE

• Gene ID:
• 5692

• Uniprot-ID:
• P28070

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, A375, SKOV3, U-251MG, Mouse thymus, Mouse skeletal muscle, Mouse liver, Rat brain, Rat heart