Rabbit anti-Human PRPF4B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05438P

• Product Name:
• Rabbit anti-Human PRPF4B Polyclonal Antibody

• Synonym:
• PR4H; PRP4; PRP4H; PRP4K; dJ1013A10.1; PRPF4B

• Description:
• The antibody against PRPF4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 550-760 of human PRPF4B (NP_003904.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 550-760 of human PRPF4B (NP_003904.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PRPF4B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHK

• Gene ID:
• 8899

• Uniprot-ID:
• Q13523

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, A-549, HeLa, Mouse liver