Rabbit anti-Human Proteinase 3/PR3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10501P

• Product Name:
• Rabbit anti-Human Proteinase 3/PR3 Polyclonal Antibody

• Synonym:
• MBN; MBT; NP4; P29; PR3; ACPA; AGP7; NP-4; PR-3; CANCA; C-ANCA; Proteinase 3/PR3

• Description:
• The antibody against Proteinase 3/PR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-170 of human Proteinase 3/PR3 (NP_002768.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 28-170 of human Proteinase 3/PR3 (NP_002768.3).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Proteinase 3/PR3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVL

• Gene ID:
• 5657

• Uniprot-ID:
• P24158

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat lung