Rabbit anti-Human Prohibitin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06197P

• Product Name:
• Rabbit anti-Human Prohibitin Polyclonal Antibody

• Synonym:
• PHB; HEL-215; HEL-S-54e; Prohibitin

• Description:
• The antibody against Prohibitin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 73-272 of human Prohibitin (NP_002625.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 73-272 of human Prohibitin (NP_002625.1).

• Species Reactivity:
• Human, Mouse, Rat, Monkey

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Prohibitin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

• Gene ID:
• 5245

• Uniprot-ID:
• P35232

• Purification Method:
• Affinity purification

• Positive Samples:
• PC-3, PC-12, Jurkat, NIH/3T3, HeLa, COS1