Rabbit anti-Human PPP2R1A/PPP2R2A/PPP2R1B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07324P

• Product Name:
• Rabbit anti-Human PPP2R1A/PPP2R2A/PPP2R1B Polyclonal Antibody

• Synonym:
• PPP2R1A/PPP2R2A/PPP2R1B

• Description:
• The antibody against PPP2R1A/PPP2R2A/PPP2R1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human PPP2R1A/PPP2R2A/PPP2R1BPPP2R1A (NP_055040.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human PPP2R1A/PPP2R2A/PPP2R1BPPP2R1A (NP_055040.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PPP2R1A/PPP2R2A/PPP2R1B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSA

• Gene ID:
• 551855205519

• Uniprot-ID:
• P30153

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, HepG2, K-562, NIH/3T3, C6, Mouse liver, Mouse lung, Rat brain, Rat testis