Rabbit anti-Human PPP1R14B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10179P

• Product Name:
• Rabbit anti-Human PPP1R14B Polyclonal Antibody

• Synonym:
• PNG; PHI-1; PLCB3N; SOM172; PPP1R14B

• Description:
• The antibody against PPP1R14B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 68-147 of human PPP1R14B (NP_619634.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 68-147 of human PPP1R14B (NP_619634.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PPP1R14B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK

• Gene ID:
• 26472

• Uniprot-ID:
• Q96C90

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, A-431