Rabbit anti-Human POU3F4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10498P

• Product Name:
• Rabbit anti-Human POU3F4 Polyclonal Antibody

• Synonym:
• BRN4; DFN3; OTF9; BRN-4; DFNX2; OCT-9; OTF-9; BRAIN-4; POU3F4

• Description:
• The antibody against POU3F4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human POU3F4 (NP_000298.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human POU3F4 (NP_000298.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• POU3F4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPT

• Gene ID:
• 5456

• Uniprot-ID:
• P49335

• Purification Method:
• Affinity purification

• Positive Samples:
• 293F transfected with POU3F4