Rabbit anti-Human POLR3K Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03005P

• Product Name:
• Rabbit anti-Human POLR3K Polyclonal Antibody

• Synonym:
• C11; HLD21; My010; RPC10; RPC11; RPC12.5; C11-RNP3; POLR3K

• Description:
• The antibody against POLR3K was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human POLR3K (NP_057394.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human POLR3K (NP_057394.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• POLR3K

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

• Gene ID:
• 51728

• Uniprot-ID:
• Q9Y2Y1

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, SW620