Rabbit anti-Human POLR2K Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00906P

• Product Name:
• Rabbit anti-Human POLR2K Polyclonal Antibody

• Synonym:
• RPB12; RPABC4; RPB7.0; hRPB7.0; hsRPB10a; RPB10alpha; ABC10-alpha; POLR2K

• Description:
• The antibody against POLR2K was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-58 of human POLR2K (NP_005025.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-58 of human POLR2K (NP_005025.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• POLR2K

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

• Gene ID:
• 5440

• Uniprot-ID:
• P53803

• Purification Method:
• Affinity purification

• Positive Samples:
• HL-60, Mouse spleen, Rat spleen