Rabbit anti-Human POLR1C Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06550P

• Product Name:
• Rabbit anti-Human POLR1C Polyclonal Antibody

• Synonym:
• AC40; RPA5; TCS3; HLD11; RPA39; RPA40; RPAC1; RPC40; POLR1C

• Description:
• The antibody against POLR1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR1C (NP_976035.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR1C (NP_976035.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• POLR1C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIA

• Gene ID:
• 9533

• Uniprot-ID:
• O15160

• Purification Method:
• Affinity purification

• Positive Samples:
• K-562, 293T, MCF7