Rabbit anti-Human Podoplanin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02651P

• Product Name:
• Rabbit anti-Human Podoplanin Polyclonal Antibody

• Synonym:
• T1A; GP36; GP40; Gp38; OTS8; T1A2; TI1A; D2-40; T1A-2; AGGRUS; HT1A-1; PA2.26; Podoplanin

• Description:
• The antibody against Podoplanin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 99-207 of human Podoplanin (Q86YL7) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 99-207 of human Podoplanin (Q86YL7).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Podoplanin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP

• Gene ID:
• 10630

• Uniprot-ID:
• Q86YL7

• Purification Method:
• Affinity purification