Rabbit anti-Human PNKD Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00021P

• Product Name:
• Rabbit anti-Human PNKD Polyclonal Antibody

• Synonym:
• R1; MR1; PDC; DYT8; FPD1; MR-1; BRP17; MR-1S; PKND1; PNKD1; FKSG19; TAHCCP2; KIPP1184; PNKD

• Description:
• The antibody against PNKD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human PNKD (NP_056303.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human PNKD (NP_056303.3).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PNKD

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAVVAATALKGRGARNARVLRGILAGATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAET

• Gene ID:
• 25953

• Uniprot-ID:
• Q8N490

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, 22Rv1, THP-1, Mouse brain, Mouse kidney