Rabbit anti-Human PLC gamma 1 (PLCG1) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07758P

• Product Name:
• Rabbit anti-Human PLC gamma 1 (PLCG1) Polyclonal Antibody

• Synonym:
• PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1; PLC gamma 1 (PLCG1)

• Description:
• The antibody against PLC gamma 1 (PLCG1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1202-1291 of human PLC gamma 1 (PLCG1) (NP_002651.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1202-1291 of human PLC gamma 1 (PLCG1) (NP_002651.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PLC gamma 1 (PLCG1)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL

• Gene ID:
• 5335

• Uniprot-ID:
• P19174

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Hep G2, 293T, Mouse lung, Rat brain