Rabbit anti-Human PLA2G16 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10019P

• Product Name:
• Rabbit anti-Human PLA2G16 Polyclonal Antibody

• Synonym:
• AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1

• Description:
• The antibody against PLA2G16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 68-162 of human PLA2G16 (NP_009000.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 68-162 of human PLA2G16 (NP_009000.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PLA2G16

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ

• Gene ID:
• 11145

• Uniprot-ID:
• P53816

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, HT-29