Rabbit anti-Human PKACα Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08213P

• Product Name:
• Rabbit anti-Human PKACα Polyclonal Antibody

• Synonym:
• PRKACA; PKACA; PPNAD4; cAMP-dependent protein kinase catalytic subunit alpha; PKACα

• Description:
• The antibody against PKACα was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 251-351 of human PKACα (NP_002721.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 251-351 of human PKACα (NP_002721.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PKACα

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

• Gene ID:
• 5566

• Uniprot-ID:
• P17612

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, NIH/3T3, Rat heart