Rabbit anti-Human Pituitary homeobox 2 (PITX2) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09946P

• Product Name:
• Rabbit anti-Human Pituitary homeobox 2 (PITX2) Polyclonal Antibody

• Synonym:
• RS; RGS; ARP1; Brx1; IDG2; IGDS; IHG2; PTX2; RIEG; ASGD4; IGDS2; IRID2; Otlx2; RIEG1; Pituitary homeobox 2 (PITX2)

• Description:
• The antibody against Pituitary homeobox 2 (PITX2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pituitary homeobox 2 (PITX2) (NP_000316.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pituitary homeobox 2 (PITX2) (NP_000316.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Pituitary homeobox 2 (PITX2)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFT

• Gene ID:
• 5308

• Uniprot-ID:
• Q99697

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, NCI-H460, HeLa, Mouse brain, Rat brain