Rabbit anti-Human PINK1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11602P

• Product Name:
• Rabbit anti-Human PINK1 Polyclonal Antibody

• Synonym:
• BRPK; PARK6; PINK1

• Description:
• The antibody against PINK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PINK1 (NP_115785.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PINK1 (NP_115785.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PINK1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• APGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLP

• Gene ID:
• 65018

• Uniprot-ID:
• Q9BXM7

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, NTERA-2, Rat heart