Rabbit anti-Human PIN4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07210P

• Product Name:
• Rabbit anti-Human PIN4 Polyclonal Antibody

• Synonym:
• EPVH; PAR14; PAR17; hEPVH; hPar14; hPar17; PIN4

• Description:
• The antibody against PIN4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-156 of human PIN4 (NP_006214.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 26-156 of human PIN4 (NP_006214.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PIN4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

• Gene ID:
• 5303

• Uniprot-ID:
• Q9Y237

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, HepG2, U-251MG, Mouse liver, Mouse brain, Rat testis, Rat brain