Rabbit anti-Human PIK3R3/p55PIK Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01612P

• Product Name:
• Rabbit anti-Human PIK3R3/p55PIK Polyclonal Antibody

• Synonym:
• p55; p55PIK; p55-GAMMA; PIK3R3/p55PIK

• Description:
• The antibody against PIK3R3/p55PIK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-388 of human PIK3R3/p55PIK (NP_003620.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 300-388 of human PIK3R3/p55PIK (NP_003620.3).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PIK3R3/p55PIK

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKK

• Gene ID:
• 8503

• Uniprot-ID:
• Q92569

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG, PC-3, 293T