Rabbit anti-Human PI4K2A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00220P

• Product Name:
• Rabbit anti-Human PI4K2A Polyclonal Antibody

• Synonym:
• PI4KII; PIK42A; PI4K2A

• Description:
• The antibody against PI4K2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 131-479 of human PI4K2A (NP_060895.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 131-479 of human PI4K2A (NP_060895.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PI4K2A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW

• Gene ID:
• 55361

• Uniprot-ID:
• Q9BTU6

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa