Rabbit anti-Human PGHS-2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08181P

• Product Name:
• Rabbit anti-Human PGHS-2 Polyclonal Antibody

• Synonym:
• COX2; COX-2; PHS-2; PGG/HS; PGHS-2; hCox-2; GRIPGHS

• Description:
• The antibody against PGHS-2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 505-604 of human COX2/PTGS2 (P35354) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 505-604 of human COX2/PTGS2 (P35354).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PGHS-2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL

• Gene ID:
• 5743

• Uniprot-ID:
• P35354

• Purification Method:
• Affinity purification

• Positive Samples:
• A549, HeLa