Rabbit anti-Human PGE receptor EP1 (PTGER1) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02297P

• Product Name:
• Rabbit anti-Human PGE receptor EP1 (PTGER1) Polyclonal Antibody

• Synonym:
• EP1; PGE receptor EP1 (PTGER1)

• Description:
• The antibody against PGE receptor EP1 (PTGER1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human PGE receptor EP1 (PGE receptor EP1 (PTGER1)) (NP_000946.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PGE receptor EP1 (PGE receptor EP1 (PTGER1)) (NP_000946.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PGE receptor EP1 (PTGER1)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VGIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLS

• Gene ID:
• 5731

• Uniprot-ID:
• P34995

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse pancreas