Rabbit anti-Human PEX19 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12131P

• Product Name:
• Rabbit anti-Human PEX19 Polyclonal Antibody

• Synonym:
• PXF; HK33; PMP1; PMPI; PXMP1; PBD12A; D1S2223E; PEX19

• Description:
• The antibody against PEX19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-299 of human PEX19 (NP_002848.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-299 of human PEX19 (NP_002848.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PEX19

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM

• Gene ID:
• 5824

• Uniprot-ID:
• P40855

• Purification Method:
• Affinity purification

• Positive Samples:
• 22Rv1, THP-1, U-87MG, Jurkat