Rabbit anti-Human Peroxiredoxin 5 (PRDX5) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11133P

• Product Name:
• Rabbit anti-Human Peroxiredoxin 5 (PRDX5) Polyclonal Antibody

• Synonym:
• PLP; ACR1; B166; PRXV; PMP20; PRDX6; prx-V; SBBI10; AOEB166; HEL-S-55; Peroxiredoxin 5 (PRDX5)

• Description:
• The antibody against Peroxiredoxin 5 (PRDX5) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 53-214 of human Peroxiredoxin 5 (PRDX5) (NP_036226.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 53-214 of human Peroxiredoxin 5 (PRDX5) (NP_036226.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Peroxiredoxin 5 (PRDX5)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

• Gene ID:
• 25824

• Uniprot-ID:
• P30044

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, HepG2, U-251MG, Mouse kidney, Mouse liver, Rat brain, Rat liver