Rabbit anti-Human Peroxiredoxin 4 (PRDX4) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10352P

• Product Name:
• Rabbit anti-Human Peroxiredoxin 4 (PRDX4) Polyclonal Antibody

• Synonym:
• PRX-4; AOE372; AOE37-2; HEL-S-97n; Peroxiredoxin 4 (PRDX4)

• Description:
• The antibody against Peroxiredoxin 4 (PRDX4) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 10-110 of human Peroxiredoxin 4 (PRDX4) (NP_006397.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 10-110 of human Peroxiredoxin 4 (PRDX4) (NP_006397.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Peroxiredoxin 4 (PRDX4)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKY

• Gene ID:
• 10549

• Uniprot-ID:
• Q13162

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, U-251MG, BxPC-3, Mouse brain, Rat brain, Rat liver