Rabbit anti-Human PEBP4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05608P

• Product Name:
• Rabbit anti-Human PEBP4 Polyclonal Antibody

• Synonym:
• CORK1; CORK-1; PEBP-4; hPEBP4; PRO4408; GWTM1933; HEL-S-300; PEBP4

• Description:
• The antibody against PEBP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human PEBP4 (NP_659399.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human PEBP4 (NP_659399.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PEBP4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKG

• Gene ID:
• 157310

• Uniprot-ID:
• Q96S96

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung