Rabbit anti-Human Pea3 / ETV4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12129P

• Product Name:
• Rabbit anti-Human Pea3 / ETV4 Polyclonal Antibody

• Synonym:
• E1AF; PEA3; E1A-F; PEAS3; Pea3 / ETV4

• Description:
• The antibody against Pea3 / ETV4 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-284 of human ETV4 (NP_001977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-284 of human ETV4 (NP_001977.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Pea3 / ETV4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHFQETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEG

• Gene ID:
• 2118

• Uniprot-ID:
• P43268

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, SW480, Mouse stomach, Mouse heart, Rat heart,