Rabbit anti-Human PDE1C Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05285P

• Product Name:
• Rabbit anti-Human PDE1C Polyclonal Antibody

• Synonym:
• Hcam3; DFNA74; hCam-3; cam-PDE 1C; PDE1C

• Description:
• The antibody against PDE1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 435-634 of human PDE1C (NP_001177985.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 435-634 of human PDE1C (NP_001177985.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PDE1C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKARLAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGKNKTDKKDHSNIGNDSKKTDDSQE

• Gene ID:
• 5137

• Uniprot-ID:
• Q14123

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, mouse heart, mouse brain, mouse testis, rat heart, rat brain, rat testis