Rabbit anti-Human PDCD4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07713P

• Product Name:
• Rabbit anti-Human PDCD4 Polyclonal Antibody

• Synonym:
• H731; PDCD4

• Description:
• The antibody against PDCD4 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-260 of human PDCD4 (NP_055271.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-260 of human PDCD4 (NP_055271.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PDCD4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQL

• Gene ID:
• 27250

• Uniprot-ID:
• Q53EL6

• Purification Method:
• Affinity purification

• Positive Samples:
• Hep G2