Rabbit anti-Human PARD6A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04196P

• Product Name:
• Rabbit anti-Human PARD6A Polyclonal Antibody

• Synonym:
• PAR6; PAR6C; TAX40; PAR-6A; TIP-40; PAR6alpha; PARD6A

• Description:
• The antibody against PARD6A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PARD6A (Q9NPB6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PARD6A (Q9NPB6).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PARD6A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADS

• Gene ID:
• 50855

• Uniprot-ID:
• Q9NPB6

• Purification Method:
• Affinity purification

• Positive Samples:
• SW620, HT-29, Jurkat, U-251MG, Raji, Mouse testis