Rabbit anti-Human PAQR8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02253P

• Product Name:
• Rabbit anti-Human PAQR8 Polyclonal Antibody

• Synonym:
• MPRB; LMPB1; C6orf33; PAQR8

• Description:
• The antibody against PAQR8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human PAQR8 (NP_588608.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human PAQR8 (NP_588608.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PAQR8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNE

• Gene ID:
• 85315

• Uniprot-ID:
• Q8TEZ7

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain, Mouse kidney, Rat kidney