Rabbit anti-Human pan-PKC Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00346P

• Product Name:
• Rabbit anti-Human pan-PKC Polyclonal Antibody

• Synonym:
• PRKCA/PRKCB/PRKCD/PRKCE/PRKCH/PRKCQ; pan-PKC

• Description:
• The antibody against pan-PKC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 572-672 of humanPRKCA (NP_002728.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 572-672 of humanPRKCA (NP_002728.2)

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• pan-PKC

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV

• Gene ID:
• 557855795580558155835588

• Uniprot-ID:
• P17252

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Jurkat, 293T, Mouse brain, Rat brain