Rabbit anti-Human p63 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11627P

• Product Name:
• Rabbit anti-Human p63 Polyclonal Antibody

• Synonym:
• AIS; KET; LMS; NBP; RHS; p40; p51; p63; EEC3; OFC8; p73H; p73L; SHFM4; TP53L; TP73L; p53CP; TP53CP; B(p51A); B(p51B)

• Description:
• The antibody against p63 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 166-362 of human p63 (NP_001108452.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 166-362 of human p63 (NP_001108452.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• p63

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSP

• Gene ID:
• 8626

• Uniprot-ID:
• Q9H3D4

• Purification Method:
• Affinity purification

• Positive Samples:
• A-431, mouse skin, rat skin