Rabbit anti-Human p53 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13025P

• Product Name:
• Rabbit anti-Human p53 Polyclonal Antibody

• Synonym:
• P53; BCC7; LFS1; BMFS5; TRP53; p53

• Description:
• The antibody against p53 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 218-390 of human p53 (NP_035770.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 218-390 of human p53 (NP_035770.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• p53

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD

• Gene ID:
• 7157

• Uniprot-ID:
• P04637

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG