Rabbit anti-Human p53 DINP1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01546P

• Product Name:
• Rabbit anti-Human p53 DINP1 Polyclonal Antibody

• Synonym:
• SIP; Teap; p53DINP1; TP53DINP1; TP53INP1A; TP53INP1B; p53 DINP1

• Description:
• The antibody against p53 DINP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human p53 DINP1 (NP_001129205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p53 DINP1 (NP_001129205.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• p53 DINP1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITP

• Gene ID:
• 94241

• Uniprot-ID:
• Q96A56

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse spleen, Mouse lung