Rabbit anti-Human p38 MAPK Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13130P

• Product Name:
• Rabbit anti-Human p38 MAPK Polyclonal Antibody

• Synonym:
• RK; p38; CSBP; EXIP; Mxi2; CSBP1; CSBP2; CSPB1; PRKM14; PRKM15; SAPK2A; p38ALPHA; p38 MAPK

• Description:
• The antibody against p38 MAPK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 261-360 of human p38 MAPK (NP_620581.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 261-360 of human p38 MAPK (NP_620581.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• p38 MAPK

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

• Gene ID:
• 1432

• Uniprot-ID:
• Q16539

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, BxPC-3, Mouse testis, Rat kidney