Rabbit anti-Human P2RY12 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04534P

• Product Name:
• Rabbit anti-Human P2RY12 Polyclonal Antibody

• Synonym:
• HORK3; P2Y12; ADPG-R; BDPLT8; SP1999; P2T(AC); P2Y(AC); P2Y(12)R; P2Y(ADP); P2Y(cyc); P2RY12

• Description:
• The antibody against P2RY12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 243-342 of human P2RY12 (NP_795345.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 243-342 of human P2RY12 (NP_795345.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• P2RY12

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

• Gene ID:
• 64805

• Uniprot-ID:
• Q9H244

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain