Rabbit anti-Human P2RX5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02032P

• Product Name:
• Rabbit anti-Human P2RX5 Polyclonal Antibody

• Synonym:
• P2X5; LRH-1; P2X5R; P2RX5

• Description:
• The antibody against P2RX5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2RX5 (NP_002552.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2RX5 (NP_002552.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• P2RX5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST

• Gene ID:
• 5026

• Uniprot-ID:
• Q93086

• Purification Method:
• Affinity purification

• Positive Samples:
• NCI-H460, U-87MG, BxPC-3, K-562, Raji, Mouse heart, Mouse kidney, Mouse skeletal muscle, Rat heart