Rabbit anti-Human p16-ARC/ARC16/ARPC5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01167P

• Product Name:
• Rabbit anti-Human p16-ARC/ARC16/ARPC5 Polyclonal Antibody

• Synonym:
• ARC16; p16-Arc; dJ127C7.3; p16-ARC/ARC16/ARPC5

• Description:
• The antibody against p16-ARC/ARC16/ARPC5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human p16-ARC/ARC16/p16-ARC/ARC16/ARPC5 (NP_001257368.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human p16-ARC/ARC16/p16-ARC/ARC16/ARPC5 (NP_001257368.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• p16-ARC/ARC16/ARPC5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

• Gene ID:
• 10092

• Uniprot-ID:
• O15511

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse spleen, Mouse small intestine, Rat brain