Rabbit anti-Human OX40L Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07275P

• Product Name:
• Rabbit anti-Human OX40L Polyclonal Antibody

• Synonym:
• GP34; CD252; OX4OL; TXGP1; CD134L; OX-40L; TNLG2B; OX40L

• Description:
• The antibody against OX40L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 51-183 of human OX40L (NP_003317.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 51-183 of human OX40L (NP_003317.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• OX40L

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

• Gene ID:
• 7292

• Uniprot-ID:
• P23510

• Purification Method:
• Affinity purification

• Positive Samples:
• Raji, PC-3, HepG2, 293T, Mouse thymus, Mouse spleen, Hep G2