Rabbit anti-Human OMA1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01586P

• Product Name:
• Rabbit anti-Human OMA1 Polyclonal Antibody

• Synonym:
• DAB1; MPRP1; MPRP-1; YKR087C; ZMPOMA1; peptidase; 2010001O09Rik; OMA1

• Description:
• The antibody against OMA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-524 of human OMA1 (NP_660286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 360-524 of human OMA1 (NP_660286.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• OMA1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS

• Gene ID:
• 115209

• Uniprot-ID:
• Q96E52

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, LO2, K-562