Rabbit anti-Human Olig2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03255P

• Product Name:
• Rabbit anti-Human Olig2 Polyclonal Antibody

• Synonym:
• BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19; Olig2

• Description:
• The antibody against Olig2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-80 of human Olig2 (NP_005797.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-80 of human Olig2 (NP_005797.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Olig2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSS

• Gene ID:
• 10215

• Uniprot-ID:
• Q13516

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, C6