Rabbit anti-Human OLFM4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05097P

• Product Name:
• Rabbit anti-Human OLFM4 Polyclonal Antibody

• Synonym:
• GC1; OLM4; OlfD; GW112; hGC-1; hOLfD; UNQ362; bA209J19.1; OLFM4

• Description:
• The antibody against OLFM4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-510 of human OLFM4 (NP_006409.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 211-510 of human OLFM4 (NP_006409.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• OLFM4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSPQHPNKGLYWVAPLNTDGRLLEYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAVTQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNTWYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLNYDLSVLQKPQ

• Gene ID:
• 10562

• Uniprot-ID:
• Q6UX06

• Purification Method:
• Affinity purification

• Positive Samples:
• PC-3, Mouse spleen, Mouse stomach, Rat stomach