Rabbit anti-Human NUR77 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11166P

• Product Name:
• Rabbit anti-Human NUR77 Polyclonal Antibody

• Synonym:
• HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77

• Description:
• The antibody against NUR77 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human NUR77 (NP_002126.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NUR77 (NP_002126.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NUR77

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK

• Gene ID:
• 3164

• Uniprot-ID:
• P22736

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, SK-BR-3, U-937(negative)